BLAST Analysis Platform

This platform provides tools for sequence alignment analysis using BLAST algorithms. Compare your query sequences against reference databases to identify homologous sequences and functional annotations.

Powerful tools for sequence similarity search.

Task Setup

Create a new BLAST analysis task.

Task Information

Task Name *

Analysis Description

Sequence Type

Nucleotide Query DNA or RNA sequence comparison

Protein Query Protein sequence comparison

Sequence Input

Enter or upload your query sequences for BLAST analysis.

Please create a task first in the "Task Setup" tab before entering sequences.

Query Sequence(s)

Enter your query sequence(s) in FASTA format. Multiple sequences are allowed.

Query Sequence File

Supported formats: FASTA (.fasta, .fas, .fa, .txt)

Upload File

Or paste sequence directly

Sequence Validation

Sequence Length

0 bp

Sequence Type Detected

Database Selection

Choose the reference database for sequence comparison.

Reference Databases

nr (Non-redundant) Comprehensive protein sequences

nt (Nucleotide) Nucleotide collection

RefSeq Protein Curated protein sequences

RefSeq RNA Curated RNA sequences

UniProt/Swiss-Prot Manually annotated protein DB

Custom Database Upload your own database

Organism Filter (Optional)

Taxonomic Group

Specific Organism

Algorithm Parameters

Set parameters for BLAST algorithm and search sensitivity.

BLAST Program

blastn Nucleotide query vs nucleotide db

blastp Protein query vs protein db

blastx Translated nucleotide vs protein db

tblastn Protein vs translated nucleotide db

tblastx Translated nucleotide vs translated db

Search Sensitivity

Expect Threshold (E-value)

Lower values mean more stringent search

Word Size

Length of initial word for seed matches

Gap Costs

Filter Low Complexity Regions

Output Parameters

Max Target Sequences

Number of aligned sequences to keep

Hit per Query

Maximum hits to report per query

Run Analysis

Review your BLAST settings and start the sequence alignment analysis.

Please complete the previous steps (create task, input sequences, select database, set parameters) before running the analysis.

BLAST Settings Summary

Task Name

My BLAST Analysis

Sequence Type

Protein Query

Database

nr (Non-redundant)

BLAST Program

blastp

E-value Threshold

Estimated Processing Time

~2-5 minutes

Note: Analysis time depends on the length and number of query sequences, as well as the size of the selected database. Complex searches may take longer.

Analysis Results

View the results of your BLAST sequence alignment analysis.

No BLAST results available yet. Please run an analysis first.

Total Queries

Queries with Hits

Total Hits

Best E-value

1e-180

BLAST Hits

Query ID	Subject ID	Identity (%)	Alignment Length	Mismatches	Gaps	E-value	Bit Score	Description
Query1	NP_001234.1	98.5	350	5	0	1e-180	650.2	Homo sapiens protein X isoform 1
Query1	XP_987654.2	89.2	340	36	2	3e-120	520.8	Macaca mulatta protein X homolog
Query1	WP_11223344.1	45.1	180	99	5	2e-15	85.3	Bacterial hypothetical protein
Query1	YP_556677.3	32.7	210	142	8	0.003	42.1	Viral protein fragment
Query1	ZP_998877.5	28.9	150	107	3	0.045	28.7	Environmental sequence protein

Showing 5 of 45 results

Alignment Details

Query  1    MTEYKLVVVGAGGVGKSALTIQHQDVKKYKLILVACDIHRQEETLRLRPLRSSDVFNSQ-
           ||||||||||||||||||||||||||||||||||||||||||||||||||||||||| 
Sbjct  1    MTEYKLVVVGAGGVGKSALTIQHQDVKKYKLILVACDIHRQEETLRLRPLRSSDVFNSQI

Query  61   LVDG-----QFLLVFTDTAGIEVRSLKEEKDPEKKKSKTKFLSNKKVIIM-DNLDIQYLR
           |||||     ||||||||||||||||||||||||||||||||||||||| ||||||||||
Sbjct  61   LVDGDLAGNEQFLLVFTDTAGIEVRSLKEEKDPEKKKSKTKFLSNKKVIIMDDNLDIQYLK

Data Visualization

Visual representations of your BLAST analysis results.

No visualizations available yet. Please run an analysis first.

Visualization Parameters

Min Identity (%)

Max E-value

Top N Hits per Query

E-value Distribution

Distribution of E-values for all BLAST hits. Lower E-values indicate more significant alignments.